SCOP 1.73: Domain d1xfoa2: 1xfo A:6-72,A:164-353

Lineage for d1xfoa2 (1xfo A:6-72,A:164-353)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (8 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (17 proteins)

6. Protein Frv operon protein FrvX, catalytic domain [117659] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [117660] (3 PDB entries)

8. Domain d1xfoa2: 1xfo A:6-72,A:164-353 [115266]
   Other proteins in same PDB: d1xfoa1, d1xfob1, d1xfoc1, d1xfod1

Details for d1xfoa2

PDB Entry: 1xfo, 1.96 Å

PDB Description: Crystal Structure of an archaeal aminopeptidase

PDB Compounds: (A:) Frv operon protein FrvX

SCOP Domain Sequences for d1xfoa2:

Sequence; same for both SEQRES and ATOM records:

>d1xfoa2 c.56.5.4 (A:6-72,A:164-353) Frv operon protein FrvX, catalytic domain {Pyrococcus horikoshii [TaxId: 53953]}
mvdyellkkvveapgvsgyeflgirdvvieeikdyvdevkvdklgnviahkkgegpkvmi
aahmdqiXwdgrlerlgkhrfvsiafddriavytilevakqlkdakadvyfvatvqeevg
lrgartsafgiepdygfaidvtiaadipgtpehkqvthlgkgtaikimdrsvichptivr
wleelakkheipyqleillgggtdagaihltkagvptgalsvparyihsntevvderdvd
atvelmtkalenihelki

Timeline for d1xfoa2:

• d1xfoa2 first appeared in SCOP 1.71
  
• d1xfoa2 appears in SCOP 1.75
  
• d1xfoa2 appears in the current release, SCOPe 2.08