Lineage for d1xfka_ (1xfk A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2115321Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2115322Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2115323Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 protein domains)
    Pfam PF00491
  6. 2115553Protein Formimidoylglutamase HutG [117573] (1 species)
  7. 2115554Species Vibrio cholerae [TaxId:666] [117574] (1 PDB entry)
    Uniprot Q9KSQ2
  8. 2115555Domain d1xfka_: 1xfk A: [115264]

Details for d1xfka_

PDB Entry: 1xfk (more details), 1.8 Å

PDB Description: 1.8a crsytal strucutre of formiminoglutamase from vibrio cholerae o1 biovar eltor str. n16961
PDB Compounds: (A:) Formimidoylglutamase

SCOPe Domain Sequences for d1xfka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xfka_ c.42.1.1 (A:) Formimidoylglutamase HutG {Vibrio cholerae [TaxId: 666]}
twqgrhdpedgqagrrvhhiacpiqvgelanqepgvaligfecdagvernkgrtgakhap
slikqalanlawhhpipiydlgnircegdeleqaqqecaqviqqalpharaivlggghei
awatfqglaqhflatgvkqprigiinfdahfdlrtfeselapvrpssgtpfnqihhfcqq
qgwdfhyaclgvsrasntpalferadklgvwyvedkafsplslkdhltqlqhfiddcdyl
yltidldvfpaasapgvsapaargvslealapyfdrilhyknklmiadiaeynpsfdidq
htarlaarlcwdianamaeqvqsi

SCOPe Domain Coordinates for d1xfka_:

Click to download the PDB-style file with coordinates for d1xfka_.
(The format of our PDB-style files is described here.)

Timeline for d1xfka_: