Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.49: Proton glutamate symport protein [118214] (1 superfamily) multihelical membrane protein; partial structural duplication in the C-terminal region; oligomeric state: trimer |
Superfamily f.49.1: Proton glutamate symport protein [118215] (1 family) automatically mapped to Pfam PF00375 |
Family f.49.1.1: Proton glutamate symport protein [118216] (2 proteins) |
Protein Proton glutamate symport protein [118217] (1 species) |
Species Pyrococcus horikoshii [TaxId:53953] [118218] (3 PDB entries) Uniprot O59010 # PH1295 |
Domain d1xfhb_: 1xfh B: [115262] |
PDB Entry: 1xfh (more details), 3.5 Å
SCOPe Domain Sequences for d1xfhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xfhb_ f.49.1.1 (B:) Proton glutamate symport protein {Pyrococcus horikoshii [TaxId: 53953]} vlqkiliglilgaivglilghygyahavhtyvkpfgdlfvrllkmlvmpivfaslvvgaa sisparlgrvgvkivvyylltsafavtlgiimarlfnpgagihlavggqqfqphqapplv hilldivptnpfgalangqvlptiffaiilgiaitylmnsenekvrksaetlldaingla eamykivngvmqyapigvfaliayvmaeqgvhvvgelakvtaavyvgltlqillvyfvll kiygidpisfikhakdamltafvtrsssgtlpvtmrvakemgisegiysftlplgatinm dgtalyqgvctffianalgshltvgqqltivltavlasigtagvpgagaimlamvlhsvg lpltdpnvaaayamilgidaildmgrtmvnvtgdltgtaivakteg
Timeline for d1xfhb_: