Lineage for d1xfhb_ (1xfh B:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028642Fold f.49: Proton glutamate symport protein [118214] (1 superfamily)
    multihelical membrane protein; partial structural duplication in the C-terminal region; oligomeric state: trimer
  4. 3028643Superfamily f.49.1: Proton glutamate symport protein [118215] (1 family) (S)
    automatically mapped to Pfam PF00375
  5. 3028644Family f.49.1.1: Proton glutamate symport protein [118216] (2 proteins)
  6. 3028645Protein Proton glutamate symport protein [118217] (1 species)
  7. 3028646Species Pyrococcus horikoshii [TaxId:53953] [118218] (3 PDB entries)
    Uniprot O59010 # PH1295
  8. 3028654Domain d1xfhb_: 1xfh B: [115262]

Details for d1xfhb_

PDB Entry: 1xfh (more details), 3.5 Å

PDB Description: structure of glutamate transporter homolog from pyrococcus horikoshii
PDB Compounds: (B:) proton glutamate symport protein

SCOPe Domain Sequences for d1xfhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xfhb_ f.49.1.1 (B:) Proton glutamate symport protein {Pyrococcus horikoshii [TaxId: 53953]}
vlqkiliglilgaivglilghygyahavhtyvkpfgdlfvrllkmlvmpivfaslvvgaa
sisparlgrvgvkivvyylltsafavtlgiimarlfnpgagihlavggqqfqphqapplv
hilldivptnpfgalangqvlptiffaiilgiaitylmnsenekvrksaetlldaingla
eamykivngvmqyapigvfaliayvmaeqgvhvvgelakvtaavyvgltlqillvyfvll
kiygidpisfikhakdamltafvtrsssgtlpvtmrvakemgisegiysftlplgatinm
dgtalyqgvctffianalgshltvgqqltivltavlasigtagvpgagaimlamvlhsvg
lpltdpnvaaayamilgidaildmgrtmvnvtgdltgtaivakteg

SCOPe Domain Coordinates for d1xfhb_:

Click to download the PDB-style file with coordinates for d1xfhb_.
(The format of our PDB-style files is described here.)

Timeline for d1xfhb_: