SCOPe 2.07: Domain d1xfha_: 1xfh A:

Lineage for d1xfha_ (1xfh A:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.49: Proton glutamate symport protein [118214] (1 superfamily)
   multihelical membrane protein; partial structural duplication in the C-terminal region; oligomeric state: trimer

4. Superfamily f.49.1: Proton glutamate symport protein [118215] (1 family)
   automatically mapped to Pfam PF00375

5. Family f.49.1.1: Proton glutamate symport protein [118216] (2 proteins)

6. Protein Proton glutamate symport protein [118217] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [118218] (3 PDB entries)
   Uniprot O59010 # PH1295

8. Domain d1xfha_: 1xfh A: [115261]

Details for d1xfha_

PDB Entry: 1xfh, 3.5 Å

PDB Description: structure of glutamate transporter homolog from pyrococcus horikoshii

PDB Compounds: (A:) proton glutamate symport protein

SCOPe Domain Sequences for d1xfha_:

Sequence; same for both SEQRES and ATOM records:

>d1xfha_ f.49.1.1 (A:) Proton glutamate symport protein {Pyrococcus horikoshii [TaxId: 53953]}
vlqkiliglilgaivglilghygyahavhtyvkpfgdlfvrllkmlvmpivfaslvvgaa
sisparlgrvgvkivvyylltsafavtlgiimarlfnpgagihlavggqqfqphqapplv
hilldivptnpfgalangqvlptiffaiilgiaitylmnsenekvrksaetlldaingla
eamykivngvmqyapigvfaliayvmaeqgvhvvgelakvtaavyvgltlqillvyfvll
kiygidpisfikhakdamltafvtrsssgtlpvtmrvakemgisegiysftlplgatinm
dgtalyqgvctffianalgshltvgqqltivltavlasigtagvpgagaimlamvlhsvg
lpltdpnvaaayamilgidaildmgrtmvnvtgdltgtaivakteg

Timeline for d1xfha_:

• d1xfha_ first appeared in SCOP 1.71
  
• d1xfha_ appears in SCOPe 2.06
  
• d1xfha_ appears in the current release, SCOPe 2.08