Class f: Membrane and cell surface proteins and peptides [56835] (49 folds) |
Fold f.49: Proton glutamate symport protein [118214] (1 superfamily) multihelical membrane protein; partial structural duplication in the C-terminal region; oligomeric state: trimer |
Superfamily f.49.1: Proton glutamate symport protein [118215] (1 family) |
Family f.49.1.1: Proton glutamate symport protein [118216] (1 protein) |
Protein Proton glutamate symport protein [118217] (1 species) |
Species Pyrococcus horikoshii [TaxId:70601] [118218] (1 PDB entry) |
Domain d1xfha_: 1xfh A: [115261] |
PDB Entry: 1xfh (more details), 3.5 Å
SCOP Domain Sequences for d1xfha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xfha_ f.49.1.1 (A:) Proton glutamate symport protein {Pyrococcus horikoshii} vlqkiliglilgaivglilghygyahavhtyvkpfgdlfvrllkmlvmpivfaslvvgaa sisparlgrvgvkivvyylltsafavtlgiimarlfnpgagihlavggqqfqphqapplv hilldivptnpfgalangqvlptiffaiilgiaitylmnsenekvrksaetlldaingla eamykivngvmqyapigvfaliayvmaeqgvhvvgelakvtaavyvgltlqillvyfvll kiygidpisfikhakdamltafvtrsssgtlpvtmrvakemgisegiysftlplgatinm dgtalyqgvctffianalgshltvgqqltivltavlasigtagvpgagaimlamvlhsvg lpltdpnvaaayamilgidaildmgrtmvnvtgdltgtaivakteg
Timeline for d1xfha_: