SCOPe 2.04: Domain d1xfea2: 1xfe A:1-44

Lineage for d1xfea2 (1xfe A:1-44)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.12: LDL receptor-like module [57423] (1 superfamily)
   disulfide-rich calcium-binding fold

4. Superfamily g.12.1: LDL receptor-like module [57424] (2 families)

5. Family g.12.1.1: LDL receptor-like module [57425] (6 proteins)

6. Protein Ligand-binding domain of low-density lipoprotein receptor [57426] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57427] (13 PDB entries)
   Uniprot P01130 272-353

8. Domain d1xfea2: 1xfe A:1-44 [115260]
   Other proteins in same PDB: d1xfea1
   complexed with ca

Details for d1xfea2

PDB Entry: 1xfe

PDB Description: solution structure of the la7-egfa pair from the ldl receptor

PDB Compounds: (A:) low-density lipoprotein receptor

SCOPe Domain Sequences for d1xfea2:

Sequence; same for both SEQRES and ATOM records:

>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}
gnvtlcegpnkfkchsgecitldkvcnmardcrdwsdepikecg

Timeline for d1xfea2:

• d1xfea2 first appeared in SCOP 1.71
  
• d1xfea2 appears in SCOPe 2.03
  
• d1xfea2 appears in SCOPe 2.05
  
• d1xfea2 appears in the current release, SCOPe 2.08