Lineage for d1xfea2 (1xfe A:1-44)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 623101Fold g.12: LDL receptor-like module [57423] (1 superfamily)
    disulfide-rich calcium-binding fold
  4. 623102Superfamily g.12.1: LDL receptor-like module [57424] (1 family) (S)
  5. 623103Family g.12.1.1: LDL receptor-like module [57425] (3 proteins)
  6. 623104Protein Ligand-binding domain of low-density lipoprotein receptor [57426] (1 species)
  7. 623105Species Human (Homo sapiens) [TaxId:9606] [57427] (11 PDB entries)
  8. 623112Domain d1xfea2: 1xfe A:1-44 [115260]
    Other proteins in same PDB: d1xfea1
    complexed with ca

Details for d1xfea2

PDB Entry: 1xfe (more details)

PDB Description: solution structure of the la7-egfa pair from the ldl receptor

SCOP Domain Sequences for d1xfea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens)}
gnvtlcegpnkfkchsgecitldkvcnmardcrdwsdepikecg

SCOP Domain Coordinates for d1xfea2:

Click to download the PDB-style file with coordinates for d1xfea2.
(The format of our PDB-style files is described here.)

Timeline for d1xfea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xfea1