SCOPe 2.01: Domain d1xfea1: 1xfe A:45-83

Lineage for d1xfea1 (1xfe A:45-83)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (7 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Low density lipoprotein (LDL) receptor, different EGF domains [64539] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64540] (7 PDB entries)
   Uniprot P01130 272-353

8. Domain d1xfea1: 1xfe A:45-83 [115259]
   Other proteins in same PDB: d1xfea2
   complexed with ca

Details for d1xfea1

PDB Entry: 1xfe

PDB Description: solution structure of the la7-egfa pair from the ldl receptor

PDB Compounds: (A:) low-density lipoprotein receptor

SCOPe Domain Sequences for d1xfea1:

Sequence; same for both SEQRES and ATOM records:

>d1xfea1 g.3.11.1 (A:45-83) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]}
tnecldnnggcshvcndlkigyeclcpdgfqlvaqrrce

Timeline for d1xfea1:

• d1xfea1 first appeared in SCOP 1.71
  
• d1xfea1 appears in SCOP 1.75
  
• d1xfea1 appears in SCOPe 2.02
  
• d1xfea1 appears in the current release, SCOPe 2.08