![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins) N-terminal domain is a 8-bladed beta-propeller automatically mapped to Pfam PF00326 |
![]() | Protein Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain [117705] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117706] (1 PDB entry) Uniprot P42658 127-849 |
![]() | Domain d1xfdc2: 1xfd C:592-849 [115256] Other proteins in same PDB: d1xfda1, d1xfdb1, d1xfdc1, d1xfdd1 |
PDB Entry: 1xfd (more details), 3 Å
SCOPe Domain Sequences for d1xfdc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xfdc2 c.69.1.24 (C:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} pkveyrdieiddynlpmqilkpatftdtthyplllvvdgtpgsqsvaekfevswetvmvs shgavvvkcdgrgsgfqgtkllhevrrrlglleekdqmeavrtmlkeqyidrtrvavfgk dyggylstyilpakgenqgqtftcgsalspitdfklyasafserylglhgldnrayemtk vahrvsaleeqqfliihptadekihfqhtaelitqlirgkanyslqiypdeshyftsssl kqhlyrsiinffvecfri
Timeline for d1xfdc2: