Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins) N-terminal domain is a 8-bladed beta-propeller |
Protein Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain [117705] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117706] (1 PDB entry) |
Domain d1xfdb2: 1xfd B:592-849 [115254] Other proteins in same PDB: d1xfda1, d1xfdb1, d1xfdc1, d1xfdd1 |
PDB Entry: 1xfd (more details), 3 Å
SCOP Domain Sequences for d1xfdb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xfdb2 c.69.1.24 (B:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} pkveyrdieiddynlpmqilkpatftdtthyplllvvdgtpgsqsvaekfevswetvmvs shgavvvkcdgrgsgfqgtkllhevrrrlglleekdqmeavrtmlkeqyidrtrvavfgk dyggylstyilpakgenqgqtftcgsalspitdfklyasafserylglhgldnrayemtk vahrvsaleeqqfliihptadekihfqhtaelitqlirgkanyslqiypdeshyftsssl kqhlyrsiinffvecfri
Timeline for d1xfdb2: