SCOPe 2.05: Domain d1xfdb1: 1xfd B:127-591

Lineage for d1xfdb1 (1xfd B:127-591)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
   consists of eight 4-stranded beta-sheet motifs; meander
   also found in some members of the WD40-repeat superfamily

4. Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family)
   automatically mapped to Pfam PF00930

5. Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
   Pfam PF00930

6. Protein Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain [117295] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117296] (1 PDB entry)
   Uniprot P42658 127-849

8. Domain d1xfdb1: 1xfd B:127-591 [115253]
   Other proteins in same PDB: d1xfda2, d1xfdb2, d1xfdc2, d1xfdd2

Details for d1xfdb1

PDB Entry: 1xfd, 3 Å

PDB Description: structure of a human a-type potassium channel accelerating factor dppx, a member of the dipeptidyl aminopeptidase family

PDB Compounds: (B:) Dipeptidyl aminopeptidase-like protein 6

SCOPe Domain Sequences for d1xfdb1:

Sequence; same for both SEQRES and ATOM records:

>d1xfdb1 b.70.3.1 (B:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
qkkkvtvedlfsedfkihdpeakwisdtefiyreqkgtvrlwnvetntstvliegkkies
lrairyeispdreyalfsynvepiyqhsytgyyvlskiphgdpqsldppevsnaklqyag
wgpkgqqlififenniyycahvgkqairvvstgkegviynglsdwlyeeeilkthiahww
spdgtrlayaaindsrvpimelptytgsiyptvkpyhypkagsenpsislhviglngpth
dlemmppddprmreyyitmvkwatstkvavtwlnraqnvsiltlcdattgvctkkhedes
eawlhrqneepvfskdgrkfffiraipqggrgkfyhitvsssqpnssndniqsitsgdwd
vtkilaydekgnkiyflstedlprrrqlysantvgnfnrqclscdlvenctyfsasfshs
mdffllkcegpgvpmvtvhnttdkkkmfdletnehvkkaindrqm

Timeline for d1xfdb1:

• d1xfdb1 first appeared in SCOP 1.71
  
• d1xfdb1 appears in SCOPe 2.04
  
• d1xfdb1 appears in SCOPe 2.06
  
• d1xfdb1 appears in the current release, SCOPe 2.08