Lineage for d1xfda2 (1xfd A:592-849)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2508876Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
    N-terminal domain is a 8-bladed beta-propeller
    automatically mapped to Pfam PF00326
  6. 2508877Protein Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain [117705] (1 species)
  7. 2508878Species Human (Homo sapiens) [TaxId:9606] [117706] (1 PDB entry)
    Uniprot P42658 127-849
  8. 2508879Domain d1xfda2: 1xfd A:592-849 [115252]
    Other proteins in same PDB: d1xfda1, d1xfdb1, d1xfdc1, d1xfdd1

Details for d1xfda2

PDB Entry: 1xfd (more details), 3 Å

PDB Description: structure of a human a-type potassium channel accelerating factor dppx, a member of the dipeptidyl aminopeptidase family
PDB Compounds: (A:) Dipeptidyl aminopeptidase-like protein 6

SCOPe Domain Sequences for d1xfda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
pkveyrdieiddynlpmqilkpatftdtthyplllvvdgtpgsqsvaekfevswetvmvs
shgavvvkcdgrgsgfqgtkllhevrrrlglleekdqmeavrtmlkeqyidrtrvavfgk
dyggylstyilpakgenqgqtftcgsalspitdfklyasafserylglhgldnrayemtk
vahrvsaleeqqfliihptadekihfqhtaelitqlirgkanyslqiypdeshyftsssl
kqhlyrsiinffvecfri

SCOPe Domain Coordinates for d1xfda2:

Click to download the PDB-style file with coordinates for d1xfda2.
(The format of our PDB-style files is described here.)

Timeline for d1xfda2: