SCOP 1.71: Domain d1xfda2: 1xfd A:592-849

Lineage for d1xfda2 (1xfd A:592-849)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
   N-terminal domain is a 8-bladed beta-propeller

6. Protein Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain [117705] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117706] (1 PDB entry)

8. Domain d1xfda2: 1xfd A:592-849 [115252]
   Other proteins in same PDB: d1xfda1, d1xfdb1, d1xfdc1, d1xfdd1

Details for d1xfda2

PDB Entry: 1xfd, 3 Å

PDB Description: structure of a human a-type potassium channel accelerating factor dppx, a member of the dipeptidyl aminopeptidase family

SCOP Domain Sequences for d1xfda2:

Sequence; same for both SEQRES and ATOM records:

>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens)}
pkveyrdieiddynlpmqilkpatftdtthyplllvvdgtpgsqsvaekfevswetvmvs
shgavvvkcdgrgsgfqgtkllhevrrrlglleekdqmeavrtmlkeqyidrtrvavfgk
dyggylstyilpakgenqgqtftcgsalspitdfklyasafserylglhgldnrayemtk
vahrvsaleeqqfliihptadekihfqhtaelitqlirgkanyslqiypdeshyftsssl
kqhlyrsiinffvecfri

Timeline for d1xfda2:

• d1xfda2 is new in SCOP 1.71
  
• d1xfda2 appears in SCOP 1.73
  
• d1xfda2 appears in the current release, SCOPe 2.08