Lineage for d1xfda2 (1xfd A:592-849)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 590154Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 590155Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 590779Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
    N-terminal domain is a 8-bladed beta-propeller
  6. 590780Protein Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain [117705] (1 species)
  7. 590781Species Human (Homo sapiens) [TaxId:9606] [117706] (1 PDB entry)
  8. 590782Domain d1xfda2: 1xfd A:592-849 [115252]
    Other proteins in same PDB: d1xfda1, d1xfdb1, d1xfdc1, d1xfdd1

Details for d1xfda2

PDB Entry: 1xfd (more details), 3 Å

PDB Description: Structure of a human A-type Potassium Channel Accelerating factor DPPX, a member of the dipeptidyl aminopeptidase family

SCOP Domain Sequences for d1xfda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens)}
pkveyrdieiddynlpmqilkpatftdtthyplllvvdgtpgsqsvaekfevswetvmvs
shgavvvkcdgrgsgfqgtkllhevrrrlglleekdqmeavrtmlkeqyidrtrvavfgk
dyggylstyilpakgenqgqtftcgsalspitdfklyasafserylglhgldnrayemtk
vahrvsaleeqqfliihptadekihfqhtaelitqlirgkanyslqiypdeshyftsssl
kqhlyrsiinffvecfri

SCOP Domain Coordinates for d1xfda2:

Click to download the PDB-style file with coordinates for d1xfda2.
(The format of our PDB-style files is described here.)

Timeline for d1xfda2: