Lineage for d1xfda1 (1xfd A:127-591)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2809844Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 2810010Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) (S)
    automatically mapped to Pfam PF00930
  5. 2810011Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
    Pfam PF00930
  6. 2810012Protein Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain [117295] (1 species)
  7. 2810013Species Human (Homo sapiens) [TaxId:9606] [117296] (1 PDB entry)
    Uniprot P42658 127-849
  8. 2810014Domain d1xfda1: 1xfd A:127-591 [115251]
    Other proteins in same PDB: d1xfda2, d1xfdb2, d1xfdc2, d1xfdd2

Details for d1xfda1

PDB Entry: 1xfd (more details), 3 Å

PDB Description: structure of a human a-type potassium channel accelerating factor dppx, a member of the dipeptidyl aminopeptidase family
PDB Compounds: (A:) Dipeptidyl aminopeptidase-like protein 6

SCOPe Domain Sequences for d1xfda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
qkkkvtvedlfsedfkihdpeakwisdtefiyreqkgtvrlwnvetntstvliegkkies
lrairyeispdreyalfsynvepiyqhsytgyyvlskiphgdpqsldppevsnaklqyag
wgpkgqqlififenniyycahvgkqairvvstgkegviynglsdwlyeeeilkthiahww
spdgtrlayaaindsrvpimelptytgsiyptvkpyhypkagsenpsislhviglngpth
dlemmppddprmreyyitmvkwatstkvavtwlnraqnvsiltlcdattgvctkkhedes
eawlhrqneepvfskdgrkfffiraipqggrgkfyhitvsssqpnssndniqsitsgdwd
vtkilaydekgnkiyflstedlprrrqlysantvgnfnrqclscdlvenctyfsasfshs
mdffllkcegpgvpmvtvhnttdkkkmfdletnehvkkaindrqm

SCOPe Domain Coordinates for d1xfda1:

Click to download the PDB-style file with coordinates for d1xfda1.
(The format of our PDB-style files is described here.)

Timeline for d1xfda1: