Lineage for d1xfaa_ (1xfa A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2112785Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 protein domains)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 2112801Protein Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain [102378] (2 species)
  7. 2112821Species Mouse (Mus musculus) [TaxId:10090] [102379] (9 PDB entries)
    Uniprot P26361 390-670
  8. 2112852Domain d1xfaa_: 1xfa A: [115249]
    complexed with acy, atp, cl, mg; mutant

Details for d1xfaa_

PDB Entry: 1xfa (more details), 3.1 Å

PDB Description: Structure of NBD1 from murine CFTR- F508R mutant
PDB Compounds: (A:) Cystic fibrosis transmembrane conductance regulator

SCOPe Domain Sequences for d1xfaa_:

Sequence, based on SEQRES records: (download)

>d1xfaa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]}
tgiimenvtafweegfgellekvqqsngdrkhssdennvsfshlclvgnpvlkninlnie
kgemlaitgstgsgktsllmlilgeleasegiikhsgrvsfcsqfswimpgtikeniirg
vsydeyryksvvkacqlqqditkfaeqdntvlgeggvtlsggqrarislaravykdadly
lldspfgyldvfteeqvfescvcklmanktrilvtskmehlrkadkililhqgssyfygt
fselqslrpdfssklmgydtfdqfteerrssiltetlrrfs

Sequence, based on observed residues (ATOM records): (download)

>d1xfaa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]}
tgiimenvtafweegfgelleksfshlclvgnpvlkninlniekgemlaitgstgsgkts
llmlilgeleasegiikhsgrvsfcsqfswimpgtikeniirgvsydeyryksvvkacql
qqditkfaeqdntvlgeggvtlsggqrarislaravykdadlylldspfgyldvfteeqv
fescvcklmanktrilvtskmehlrkadkililhqgssyfygtfselqslrpdfssklmg
ydtfdqfteerrssiltetlrrfs

SCOPe Domain Coordinates for d1xfaa_:

Click to download the PDB-style file with coordinates for d1xfaa_.
(The format of our PDB-style files is described here.)

Timeline for d1xfaa_: