Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology missing some secondary structures that made up less than one-third of the common domain |
Protein Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain [102378] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [102379] (9 PDB entries) Uniprot P26361 390-670 |
Domain d1xf9b_: 1xf9 B: [115246] Other proteins in same PDB: d1xf9c2 complexed with acy, atp, mg; mutant |
PDB Entry: 1xf9 (more details), 2.7 Å
SCOPe Domain Sequences for d1xf9b_:
Sequence, based on SEQRES records: (download)
>d1xf9b_ c.37.1.12 (B:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} ttgiimenvtafweegfgellekvqqsngdrkhssdennvsfshlclvgnpvlkninlni ekgemlaitgstgsgktsllmlilgeleasegiikhsgrvsfcsqfswimpgtikeniis gvsydeyryksvvkacqlqqditkfaeqdntvlgeggvtlsggqrarislaravykdadl ylldspfgyldvfteeqvfescvcklmanktrilvtskmehlrkadkililhqgssyfyg tfselqslrpdfssklmgydtfdqfteerrssiltetlrrfs
>d1xf9b_ c.37.1.12 (B:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} ttgiimenvtafweegfgelleksfshlclvgnpvlkninlniekgemlaitgstgsgkt sllmlilgeleasegiikhsgrvsfcsqfswimpgtikeniisgvsydeyryksvvkacq lqqditkfaeqdntvlgeggvtlsggqrarislaravykdadlylldspfgyldvfteeq vfescvcklmanktrilvtskmehlrkadkililhqgssyfygtfselqslrpdfssklm gydtfdqfteerrssiltetlrrfs
Timeline for d1xf9b_:
View in 3D Domains from other chains: (mouse over for more information) d1xf9a_, d1xf9c1, d1xf9c2, d1xf9d_ |