Lineage for d1xf6d_ (1xf6 D:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 531798Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
  6. 531915Protein Phycoerythrin beta subunit [88513] (4 species)
  7. 531916Species Cryptophite (Rhodomonas sp.), cs24 [46544] (3 PDB entries)
  8. 531920Domain d1xf6d_: 1xf6 D: [115243]
    Other proteins in same PDB: d1xf6a_, d1xf6b_
    complexed with cl, dbv, mo6, peb

Details for d1xf6d_

PDB Entry: 1xf6 (more details), 1.1 Å

PDB Description: High resolution crystal structure of phycoerythrin 545 from the marine cryptophyte rhodomonas CS24

SCOP Domain Sequences for d1xf6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xf6d_ a.1.1.3 (D:) Phycoerythrin beta subunit {Cryptophite (Rhodomonas sp.), cs24}
mldafsrvvtnadskaayvggadlqalkkfisegnkrldsvnsivsnascivsdavsgmi
cenpslispsgncytnrrmaaclrdgeiilryvsyallsgdasvledrclnglketyssl
gvpansnaravsimkacavafvnntasqkklstpqgdcsglasevggyfdkvtaais

SCOP Domain Coordinates for d1xf6d_:

Click to download the PDB-style file with coordinates for d1xf6d_.
(The format of our PDB-style files is described here.)

Timeline for d1xf6d_: