Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
Protein Phycoerythrin beta subunit [88513] (4 species) |
Species Cryptophyte (Rhodomonas sp. CS24) [TaxId:79257] [46544] (3 PDB entries) Uniprot P27198 |
Domain d1xf6c_: 1xf6 C: [115242] Other proteins in same PDB: d1xf6a_, d1xf6b_ complexed with cl, dbv, mg, peb |
PDB Entry: 1xf6 (more details), 1.1 Å
SCOPe Domain Sequences for d1xf6c_:
Sequence, based on SEQRES records: (download)
>d1xf6c_ a.1.1.3 (C:) Phycoerythrin beta subunit {Cryptophyte (Rhodomonas sp. CS24) [TaxId: 79257]} dafsrvvtnadskaayvggadlqalkkfisegnkrldsvnsivsnascivsdavsgmice npslispsgncytnrrmaaclrdgeiilryvsyallsgdasvledrclnglketysslgv pansnaravsimkacavafvnntasqkklstpqgdcsglasevggyfdkvtaais
>d1xf6c_ a.1.1.3 (C:) Phycoerythrin beta subunit {Cryptophyte (Rhodomonas sp. CS24) [TaxId: 79257]} dafsrvvadskaayvggadlqalkkfisegnkrldsvnsivsnascivsdavsgmicenp slispsgncytnrrmaaclrdgeiilryvsyallsgdasvledrclnglketysslgvpa nsnaravsimkacavafvnntasqkklstpqgdcsglasevggyfdkvtaais
Timeline for d1xf6c_: