SCOPe 2.05: Domain d1xf6c_: 1xf6 C:

Lineage for d1xf6c_ (1xf6 C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein Phycoerythrin beta subunit [88513] (4 species)

7. Species Cryptophyte (Rhodomonas sp. CS24) [TaxId:79257] [46544] (3 PDB entries)
   Uniprot P27198

8. Domain d1xf6c_: 1xf6 C: [115242]
   Other proteins in same PDB: d1xf6a_, d1xf6b_
   complexed with cl, dbv, mg, peb

Details for d1xf6c_

PDB Entry: 1xf6, 1.1 Å

PDB Description: High resolution crystal structure of phycoerythrin 545 from the marine cryptophyte rhodomonas CS24

PDB Compounds: (C:) B-phycoerythrin beta chain

SCOPe Domain Sequences for d1xf6c_:

Sequence, based on SEQRES records:

>d1xf6c_ a.1.1.3 (C:) Phycoerythrin beta subunit {Cryptophyte (Rhodomonas sp. CS24) [TaxId: 79257]}
dafsrvvtnadskaayvggadlqalkkfisegnkrldsvnsivsnascivsdavsgmice
npslispsgncytnrrmaaclrdgeiilryvsyallsgdasvledrclnglketysslgv
pansnaravsimkacavafvnntasqkklstpqgdcsglasevggyfdkvtaais

Sequence, based on observed residues (ATOM records):

>d1xf6c_ a.1.1.3 (C:) Phycoerythrin beta subunit {Cryptophyte (Rhodomonas sp. CS24) [TaxId: 79257]}
dafsrvvadskaayvggadlqalkkfisegnkrldsvnsivsnascivsdavsgmicenp
slispsgncytnrrmaaclrdgeiilryvsyallsgdasvledrclnglketysslgvpa
nsnaravsimkacavafvnntasqkklstpqgdcsglasevggyfdkvtaais

Timeline for d1xf6c_:

• d1xf6c_ first appeared in SCOP 1.71
  
• d1xf6c_ appears in SCOPe 2.04
  
• d1xf6c_ appears in SCOPe 2.06
  
• d1xf6c_ appears in the current release, SCOPe 2.08