Lineage for d1xf6c_ (1xf6 C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1978832Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 protein domains)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1978990Protein Phycoerythrin beta subunit [88513] (4 species)
  7. 1978991Species Cryptophyte (Rhodomonas sp. CS24) [TaxId:79257] [46544] (3 PDB entries)
    Uniprot P27198
  8. 1978994Domain d1xf6c_: 1xf6 C: [115242]
    Other proteins in same PDB: d1xf6a_, d1xf6b_
    complexed with cl, dbv, mg, peb

Details for d1xf6c_

PDB Entry: 1xf6 (more details), 1.1 Å

PDB Description: High resolution crystal structure of phycoerythrin 545 from the marine cryptophyte rhodomonas CS24
PDB Compounds: (C:) B-phycoerythrin beta chain

SCOPe Domain Sequences for d1xf6c_:

Sequence, based on SEQRES records: (download)

>d1xf6c_ a.1.1.3 (C:) Phycoerythrin beta subunit {Cryptophyte (Rhodomonas sp. CS24) [TaxId: 79257]}
dafsrvvtnadskaayvggadlqalkkfisegnkrldsvnsivsnascivsdavsgmice
npslispsgncytnrrmaaclrdgeiilryvsyallsgdasvledrclnglketysslgv
pansnaravsimkacavafvnntasqkklstpqgdcsglasevggyfdkvtaais

Sequence, based on observed residues (ATOM records): (download)

>d1xf6c_ a.1.1.3 (C:) Phycoerythrin beta subunit {Cryptophyte (Rhodomonas sp. CS24) [TaxId: 79257]}
dafsrvvadskaayvggadlqalkkfisegnkrldsvnsivsnascivsdavsgmicenp
slispsgncytnrrmaaclrdgeiilryvsyallsgdasvledrclnglketysslgvpa
nsnaravsimkacavafvnntasqkklstpqgdcsglasevggyfdkvtaais

SCOPe Domain Coordinates for d1xf6c_:

Click to download the PDB-style file with coordinates for d1xf6c_.
(The format of our PDB-style files is described here.)

Timeline for d1xf6c_: