Lineage for d1xf6b_ (1xf6 B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1943267Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily)
    not a true fold
  4. 1943268Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (4 families) (S)
    not a true superfamily
  5. 1943269Family d.184.1.1: Phycoerythrin 545 alpha-subunits [56569] (1 protein)
    consists of a long beta-hairpin and a single alpha-helix
  6. 1943270Protein Phycoerythrin 545 alpha-subunits [56570] (1 species)
  7. 1943271Species Cryptophyte (Rhodomonas sp. CS24) [TaxId:79257] [56571] (3 PDB entries)
    Uniprot P30943 38-104 ! Uniprot Q00433 53-128
  8. 1943275Domain d1xf6b_: 1xf6 B: [115241]
    Other proteins in same PDB: d1xf6c_, d1xf6d_
    complexed with cl, dbv, mg, peb

Details for d1xf6b_

PDB Entry: 1xf6 (more details), 1.1 Å

PDB Description: High resolution crystal structure of phycoerythrin 545 from the marine cryptophyte rhodomonas CS24
PDB Compounds: (B:) Phycoerythrin alpha-2 chain

SCOPe Domain Sequences for d1xf6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xf6b_ d.184.1.1 (B:) Phycoerythrin 545 alpha-subunits {Cryptophyte (Rhodomonas sp. CS24) [TaxId: 79257]}
amdksakapvitifdhrgcsrapkeytgakaggkddemmvkaqsvkievstgtaegvlat
slakmtk

SCOPe Domain Coordinates for d1xf6b_:

Click to download the PDB-style file with coordinates for d1xf6b_.
(The format of our PDB-style files is described here.)

Timeline for d1xf6b_: