SCOPe 2.05: Domain d1xf6a_: 1xf6 A:

Lineage for d1xf6a_ (1xf6 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily)
   not a true fold

4. Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (4 families)
   not a true superfamily

5. Family d.184.1.1: Phycoerythrin 545 alpha-subunits [56569] (1 protein)
   consists of a long beta-hairpin and a single alpha-helix

6. Protein Phycoerythrin 545 alpha-subunits [56570] (1 species)

7. Species Cryptophyte (Rhodomonas sp. CS24) [TaxId:79257] [56571] (3 PDB entries)
   Uniprot P30943 38-104 ! Uniprot Q00433 53-128

8. Domain d1xf6a_: 1xf6 A: [115240]
   Other proteins in same PDB: d1xf6c_, d1xf6d_
   complexed with cl, dbv, mg, peb

Details for d1xf6a_

PDB Entry: 1xf6, 1.1 Å

PDB Description: High resolution crystal structure of phycoerythrin 545 from the marine cryptophyte rhodomonas CS24

PDB Compounds: (A:) Phycoerythrin alpha-3 chain

SCOPe Domain Sequences for d1xf6a_:

Sequence; same for both SEQRES and ATOM records:

>d1xf6a_ d.184.1.1 (A:) Phycoerythrin 545 alpha-subunits {Cryptophyte (Rhodomonas sp. CS24) [TaxId: 79257]}
amdksakapqitifdhrgcsrapkestggkaggqddemmvkvastkvtvsesdaakklqe
fitfekgidgpftskn

Timeline for d1xf6a_:

• d1xf6a_ first appeared in SCOP 1.71
  
• d1xf6a_ appears in SCOPe 2.04
  
• d1xf6a_ appears in SCOPe 2.06
  
• d1xf6a_ appears in the current release, SCOPe 2.08