SCOP 1.75: Domain d1xeya_: 1xey A:

Lineage for d1xeya_ (1xey A:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (9 families)

5. Family c.67.1.6: Pyridoxal-dependent decarboxylase [69565] (3 proteins)

6. Protein Glutamate decarboxylase alpha, GadA [117695] (1 species)

7. Species Escherichia coli [TaxId:562] [117696] (1 PDB entry)
   Uniprot P69908

8. Domain d1xeya_: 1xey A: [115237]

Details for d1xeya_

PDB Entry: 1xey, 2.05 Å

PDB Description: Crystal structure of the complex of Escherichia coli GADA with glutarate at 2.05 A resolution

PDB Compounds: (A:) Glutamate decarboxylase alpha

SCOP Domain Sequences for d1xeya_:

Sequence; same for both SEQRES and ATOM records:

>d1xeya_ c.67.1.6 (A:) Glutamate decarboxylase alpha, GadA {Escherichia coli [TaxId: 562]}
klltdfrselldsrfgakaistiaeskrfplhemrddvafqiindelyldgnarqnlatf
cqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavgtnt
igsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelreipmr
pgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididmhid
aasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelvfnv
dylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiaklgpy
efictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivvmri
mcrrgfemdfaellledykaslkylsdh

Timeline for d1xeya_:

• d1xeya_ first appeared in SCOP 1.71
  
• d1xeya_ appears in SCOP 1.73
  
• d1xeya_ appears in SCOPe 2.01
  
• d1xeya_ appears in the current release, SCOPe 2.08