Lineage for d1xeya_ (1xey A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896540Family c.67.1.6: Pyridoxal-dependent decarboxylase [69565] (4 proteins)
    automatically mapped to Pfam PF00282
  6. 2896547Protein Glutamate decarboxylase alpha, GadA [117695] (1 species)
  7. 2896548Species Escherichia coli [TaxId:562] [117696] (1 PDB entry)
    Uniprot P69908
  8. 2896549Domain d1xeya_: 1xey A: [115237]
    complexed with act, gua, plp

Details for d1xeya_

PDB Entry: 1xey (more details), 2.05 Å

PDB Description: Crystal structure of the complex of Escherichia coli GADA with glutarate at 2.05 A resolution
PDB Compounds: (A:) Glutamate decarboxylase alpha

SCOPe Domain Sequences for d1xeya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xeya_ c.67.1.6 (A:) Glutamate decarboxylase alpha, GadA {Escherichia coli [TaxId: 562]}
klltdfrselldsrfgakaistiaeskrfplhemrddvafqiindelyldgnarqnlatf
cqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavgtnt
igsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelreipmr
pgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididmhid
aasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelvfnv
dylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiaklgpy
efictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivvmri
mcrrgfemdfaellledykaslkylsdh

SCOPe Domain Coordinates for d1xeya_:

Click to download the PDB-style file with coordinates for d1xeya_.
(The format of our PDB-style files is described here.)

Timeline for d1xeya_: