Lineage for d1xex.1 (1xex A:,B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2112785Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 protein domains)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 2113019Protein Smc head domain [52693] (3 species)
  7. 2113025Species Pyrococcus furiosus [TaxId:2261] [117545] (2 PDB entries)
    Uniprot Q877I1 1-167,1012-1173
  8. 2113027Domain d1xex.1: 1xex A:,B: [115236]
    complexed with atp, mg

Details for d1xex.1

PDB Entry: 1xex (more details), 2.5 Å

PDB Description: Structural biochemistry of ATP-driven dimerization and DNA stimulated activation of SMC ATPases.
PDB Compounds: (A:) SMC protein, (B:) SMC protein

SCOPe Domain Sequences for d1xex.1:

Sequence, based on SEQRES records: (download)

>g1xex.1 c.37.1.12 (A:,B:) Smc head domain {Pyrococcus furiosus [TaxId: 2261]}
pyieklelkgfksygnkkvvipfskgftaivgangsgksnigdailfvlgglsakamras
risdlifagskneppakyaevaiyfnnedrgfpidedevvirrrvypdgrssywlngrra
trseildiltaamispdgynivlqgditkfikmsplerrlliddisXkknvfmrtfeais
rnfseifaklspggsarlilenpedpfsggleieakpagkdvkrieamsggekaltalaf
vfaiqkfkpapfylfdqidahlddanvkrvadlikesskesqfivitlrdvmmanadkii
gvsmrdgvskvvslslekamkileeirkkqg

Sequence, based on observed residues (ATOM records): (download)

>g1xex.1 c.37.1.12 (A:,B:) Smc head domain {Pyrococcus furiosus [TaxId: 2261]}
pyieklelkgfksygnkkvvipfskgftaivgangsgksnigdailfvlgglsakamras
risdlifagskneppakyaevaiyfnnedrgfpidedevvirrrvypdgrssywlngrra
trseildiltaamispdgynivlqgditkfikmsplerrlliddisXkknvfmrtfeais
rnfseifaklspggsarlilenpfsggleieakpagkdvkrieamsggekaltalafvfa
iqkfkpapfylfdqidahlddanvkrvadlikesskesqfivitlrdvmmanadkiigvs
mrdgvskvvslslekamkileeirkkqg

SCOPe Domain Coordinates for d1xex.1:

Click to download the PDB-style file with coordinates for d1xex.1.
(The format of our PDB-style files is described here.)

Timeline for d1xex.1: