![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology missing some secondary structures that made up less than one-third of the common domain |
![]() | Protein Smc head domain [52693] (3 species) |
![]() | Species Pyrococcus furiosus [TaxId:2261] [117545] (2 PDB entries) Uniprot Q877I1 1-167,1012-1173 |
![]() | Domain d1xew.1: 1xew X:,Y: [115235] |
PDB Entry: 1xew (more details), 2 Å
SCOPe Domain Sequences for d1xew.1:
Sequence, based on SEQRES records: (download)
>g1xew.1 c.37.1.12 (X:,Y:) Smc head domain {Pyrococcus furiosus [TaxId: 2261]} mpyieklelkgfksygnkkvvipfskgftaivgangsgksnigdailfvlgglsakamra srisdlifagskneppakyaevaiyfnnedrgfpidedevvirrrvypdgrssywlngrr atrseildiltaamispdgynivlqgditkfikmsplerrlliddisXvfmrtfeaisrn fseifaklspggsarlilenpedpfsggleieakpagkdvkrieamsggekaltalafvf aiqkfkpapfylfdeidahlddanvkrvadlikesskesqfivitlrdvmmanadkiigv smrdgvskvvslslekamkileeirkkqgw
>g1xew.1 c.37.1.12 (X:,Y:) Smc head domain {Pyrococcus furiosus [TaxId: 2261]} mpyieklelkgfksygnkkvvipfskgftaivgangsgksnigdailfvlgglsakakya evaiyfnnedrgfpidedevvirrrvypdgrssywlngrratrseildiltaamispdgy nivlqgditkfikmsplerrlliddisXvfmrtfeaisrnfseifaklspggsarlilen pedpfsggleieakpagkdvkrieamsggekaltalafvfaiqkfkpapfylfdeidahl ddanvkrvadlikesskesqfivitlrdvmmanadkiigvsmgvskvvslslekamkile eirkkqgw
Timeline for d1xew.1: