SCOPe 2.01: Domain d1xedf_: 1xed F:

Lineage for d1xedf_ (1xed F:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Polymeric-immunoglobulin receptor, PIGR [117038] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117039] (1 PDB entry)
   Uniprot P01833 20-127 # N-terminal, ligand-binding domain

8. Domain d1xedf_: 1xed F: [115234]
   complexed with mg

Details for d1xedf_

PDB Entry: 1xed, 1.9 Å

PDB Description: Crystal Structure of a Ligand-Binding Domain of the Human Polymeric Ig Receptor, pIgR

PDB Compounds: (F:) Polymeric-immunoglobulin receptor

SCOPe Domain Sequences for d1xedf_:

Sequence; same for both SEQRES and ATOM records:

>d1xedf_ b.1.1.1 (F:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]}
spifgpeevnsvegnsvsitcyypptsvnrhtrkywcrqgarggcitlissegyvsskya
granltnfpengtfvvniaqlsqddsgrykcglginsrglsfdvslevleh

Timeline for d1xedf_:

• d1xedf_ first appeared in SCOP 1.71
  
• d1xedf_ appears in SCOP 1.75
  
• d1xedf_ appears in SCOPe 2.02
  
• d1xedf_ appears in the current release, SCOPe 2.08, called d1xedf1