Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Polymeric-immunoglobulin receptor, PIGR [117038] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117039] (1 PDB entry) Uniprot P01833 20-127 # N-terminal, ligand-binding domain |
Domain d1xedf_: 1xed F: [115234] complexed with mg |
PDB Entry: 1xed (more details), 1.9 Å
SCOPe Domain Sequences for d1xedf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xedf_ b.1.1.1 (F:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]} spifgpeevnsvegnsvsitcyypptsvnrhtrkywcrqgarggcitlissegyvsskya granltnfpengtfvvniaqlsqddsgrykcglginsrglsfdvslevleh
Timeline for d1xedf_: