SCOP 1.75: Domain d1xeda_: 1xed A:

Lineage for d1xeda_ (1xed A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Polymeric-immunoglobulin receptor, PIGR [117038] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117039] (1 PDB entry)
   Uniprot P01833 20-127 # N-terminal, ligand-binding domain

8. Domain d1xeda_: 1xed A: [115229]

Details for d1xeda_

PDB Entry: 1xed, 1.9 Å

PDB Description: Crystal Structure of a Ligand-Binding Domain of the Human Polymeric Ig Receptor, pIgR

PDB Compounds: (A:) Polymeric-immunoglobulin receptor

SCOP Domain Sequences for d1xeda_:

Sequence, based on SEQRES records:

>d1xeda_ b.1.1.1 (A:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]}
spifgpeevnsvegnsvsitcyypptsvnrhtrkywcrqgarggcitlissegyvsskya
granltnfpengtfvvniaqlsqddsgrykcglginsrglsfdvslevlehhhhhh

Sequence, based on observed residues (ATOM records):

>d1xeda_ b.1.1.1 (A:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]}
spifgpeevnsvegnsvsitcyypptsvnrhtrkywcrqcitlissegyvsskyagranl
tnfpengtfvvniaqlsqddsgrykcglginsrglsfdvslevlehhhhhh

Timeline for d1xeda_:

• d1xeda_ first appeared in SCOP 1.71
  
• d1xeda_ appears in SCOP 1.73
  
• d1xeda_ appears in SCOPe 2.01
  
• d1xeda_ appears in the current release, SCOPe 2.08, called d1xeda1