Lineage for d1xecb_ (1xec B:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 823992Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 824043Superfamily c.10.2: L domain-like [52058] (8 families) (S)
    less regular structure consisting of variable repeats
  5. 824152Family c.10.2.7: Ngr ectodomain-like [75142] (6 proteins)
    this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain
  6. 824153Protein Decorin [117463] (1 species)
  7. 824154Species Cow (Bos taurus) [TaxId:9913] [117464] (3 PDB entries)
    Uniprot P21793 52-356
  8. 824158Domain d1xecb_: 1xec B: [115228]
    complexed with nag

Details for d1xecb_

PDB Entry: 1xec (more details), 2.3 Å

PDB Description: dimeric bovine tissue-extracted decorin, crystal form 2
PDB Compounds: (B:) Decorin

SCOP Domain Sequences for d1xecb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xecb_ c.10.2.7 (B:) Decorin {Cow (Bos taurus) [TaxId: 9913]}
gpvcpfrcqchlrvvqcsdlglekvpkdlppdtalldlqnnkiteikdgdfknlknlhtl
ilinnkiskispgafaplvklerlylsknqlkelpekmpktlqelrvheneitkvrksvf
nglnqmivvelgtnplkssgiengafqgmkklsyiriadtnittipqglppsltelhldg
nkitkvdaaslkglnnlaklglsfnsisavdngslantphlrelhlnnnklvkvpgglad
hkyiqvvylhnnnisaigsndfcppgyntkkasysgvslfsnpvqyweiqpstfrcvyvr
aavql

SCOP Domain Coordinates for d1xecb_:

Click to download the PDB-style file with coordinates for d1xecb_.
(The format of our PDB-style files is described here.)

Timeline for d1xecb_: