Lineage for d1xeca_ (1xec A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 577591Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 577632Superfamily c.10.2: L domain-like [52058] (8 families) (S)
    less regular structure consisting of variable repeats
  5. 577718Family c.10.2.7: Ngr ectodomain-like [75142] (4 proteins)
  6. 577719Protein Decorin [117463] (1 species)
  7. 577720Species Cow (Bos taurus) [TaxId:9913] [117464] (3 PDB entries)
  8. 577723Domain d1xeca_: 1xec A: [115227]

Details for d1xeca_

PDB Entry: 1xec (more details), 2.3 Å

PDB Description: Dimeric bovine tissue-extracted decorin, crystal form 2

SCOP Domain Sequences for d1xeca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xeca_ c.10.2.7 (A:) Decorin {Cow (Bos taurus)}
gpvcpfrcqchlrvvqcsdlglekvpkdlppdtalldlqnnkiteikdgdfknlknlhtl
ilinnkiskispgafaplvklerlylsknqlkelpekmpktlqelrvheneitkvrksvf
nglnqmivvelgtnplkssgiengafqgmkklsyiriadtnittipqglppsltelhldg
nkitkvdaaslkglnnlaklglsfnsisavdngslantphlrelhlnnnklvkvpgglad
hkyiqvvylhnnnisaigsndfcppgyntkkasysgvslfsnpvqyweiqpstfrcvyvr
aavql

SCOP Domain Coordinates for d1xeca_:

Click to download the PDB-style file with coordinates for d1xeca_.
(The format of our PDB-style files is described here.)

Timeline for d1xeca_: