Lineage for d1xebd_ (1xeb D:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1426873Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1426874Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1426875Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 1427003Protein Hypothetical protein PA0115 [118066] (1 species)
  7. 1427004Species Pseudomonas aeruginosa [TaxId:287] [118067] (1 PDB entry)
    Uniprot Q9I717
  8. 1427008Domain d1xebd_: 1xeb D: [115222]
    Structural genomics target

Details for d1xebd_

PDB Entry: 1xeb (more details), 2.35 Å

PDB Description: Crystal Structure of an Acyl-CoA N-acyltransferase from Pseudomonas aeruginosa
PDB Compounds: (D:) hypothetical protein PA0115

SCOPe Domain Sequences for d1xebd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xebd_ d.108.1.1 (D:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]}
ldwtckhhadltlkelyallqlrtevfvveqkcpyqevdgldlvgdthhlmawrdgqlla
ylrlldpvrhegqvvigrvvsssaargqglghqlmeralqaaerlwldtpvylsaqahlq
ayygrygfvavtevyleddiphigmrra

SCOPe Domain Coordinates for d1xebd_:

Click to download the PDB-style file with coordinates for d1xebd_.
(The format of our PDB-style files is described here.)

Timeline for d1xebd_: