Lineage for d1xebc_ (1xeb C:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 609081Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 609082Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (5 families) (S)
  5. 609083Family d.108.1.1: N-acetyl transferase, NAT [55730] (25 proteins)
  6. 609170Protein Hypothetical protein PA0115 [118066] (1 species)
  7. 609171Species Pseudomonas aeruginosa [TaxId:287] [118067] (1 PDB entry)
  8. 609174Domain d1xebc_: 1xeb C: [115221]

Details for d1xebc_

PDB Entry: 1xeb (more details), 2.35 Å

PDB Description: Crystal Structure of an Acyl-CoA N-acyltransferase from Pseudomonas aeruginosa

SCOP Domain Sequences for d1xebc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xebc_ d.108.1.1 (C:) Hypothetical protein PA0115 {Pseudomonas aeruginosa}
sldwtckhhadltlkelyallqlrtevfvveqkcpyqevdgldlvgdthhlmawrdgqll
aylrlldpvrhegqvvigrvvsssaargqglghqlmeralqaaerlwldtpvylsaqahl
qayygrygfvavtevyleddiphigmrra

SCOP Domain Coordinates for d1xebc_:

Click to download the PDB-style file with coordinates for d1xebc_.
(The format of our PDB-style files is described here.)

Timeline for d1xebc_: