![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
![]() | Protein Hypothetical protein PA0115 [118066] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [118067] (1 PDB entry) Uniprot Q9I717 |
![]() | Domain d1xeba_: 1xeb A: [115219] Structural genomics target |
PDB Entry: 1xeb (more details), 2.35 Å
SCOPe Domain Sequences for d1xeba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xeba_ d.108.1.1 (A:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]} sldwtckhhadltlkelyallqlrtevfvveqkcpyqevdgldlvgdthhlmawrdgqll aylrlldpvrhegqvvigrvvsssaargqglghqlmeralqaaerlwldtpvylsaqahl qayygrygfvavtevyleddiphigmrra
Timeline for d1xeba_: