Lineage for d1xe8c1 (1xe8 C:9-201)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2423915Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2424406Family b.82.1.16: YML079-like [117318] (4 proteins)
    Pfam PF06172; DUF985
  6. 2424419Protein Hypothetical protein YML079W [117319] (1 species)
  7. 2424420Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117320] (2 PDB entries)
    Uniprot Q03629
  8. 2424426Domain d1xe8c1: 1xe8 C:9-201 [115218]
    Other proteins in same PDB: d1xe8a2, d1xe8b2, d1xe8c2
    Structural genomics target
    complexed with ade, cit, gol

Details for d1xe8c1

PDB Entry: 1xe8 (more details), 2.8 Å

PDB Description: crystal structure of the yml079w protein from saccharomyces cerevisiae reveals a new sequence family of the jelly roll fold.
PDB Compounds: (C:) Hypothetical 22.5 kDa protein in TUB1-CPR3 intergenic region

SCOPe Domain Sequences for d1xe8c1:

Sequence, based on SEQRES records: (download)

>d1xe8c1 b.82.1.16 (C:9-201) Hypothetical protein YML079W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
anaaiepasfvkvpmpeppsslqqlindwqlikhreggyfketdrspytmevekpvnggs
gntemvtrnqstliyylltpdspigkfhkninriihilqrgkgqyvlvypdgqvksfkvg
fdykngevsqwvvpggvfkasfllpneefdngflisevvvpgfdfedhtflkgedelkhl
vgpekaaelafla

Sequence, based on observed residues (ATOM records): (download)

>d1xe8c1 b.82.1.16 (C:9-201) Hypothetical protein YML079W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
anaaiepasfvkvpmpeppsslqqlindwqlikhreggyfketdrspytmevekptemvt
rnqstliyylltpdspigkfhkninriihilqrgkgqyvlvypdgqvksfkvgfdyknge
vsqwvvpggvfkasfllpneefdngflisevvvpgfdfedhtflkgedelkhlvgpekaa
elafla

SCOPe Domain Coordinates for d1xe8c1:

Click to download the PDB-style file with coordinates for d1xe8c1.
(The format of our PDB-style files is described here.)

Timeline for d1xe8c1: