SCOP 1.71: Domain d1xe8c_: 1xe8 C:

Lineage for d1xe8c_ (1xe8 C:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (16 families)

5. Family b.82.1.16: YML079-like [117318] (1 protein)
   Pfam 06172; DUF985

6. Protein Hypothetical protein YML079W [117319] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117320] (2 PDB entries)

8. Domain d1xe8c_: 1xe8 C: [115218]
   Structural genomics target
   complexed with ade, cit, gol

Details for d1xe8c_

PDB Entry: 1xe8, 2.8 Å

PDB Description: crystal structure of the yml079w protein from saccharomyces cerevisiae reveals a new sequence family of the jelly roll fold.

SCOP Domain Sequences for d1xe8c_:

Sequence, based on SEQRES records:

>d1xe8c_ b.82.1.16 (C:) Hypothetical protein YML079W {Baker's yeast (Saccharomyces cerevisiae)}
anaaiepasfvkvpmpeppsslqqlindwqlikhreggyfketdrspytmevekpvnggs
gntemvtrnqstliyylltpdspigkfhkninriihilqrgkgqyvlvypdgqvksfkvg
fdykngevsqwvvpggvfkasfllpneefdngflisevvvpgfdfedhtflkgedelkhl
vgpekaaelaflahh

Sequence, based on observed residues (ATOM records):

>d1xe8c_ b.82.1.16 (C:) Hypothetical protein YML079W {Baker's yeast (Saccharomyces cerevisiae)}
anaaiepasfvkvpmpeppsslqqlindwqlikhreggyfketdrspytmevekptemvt
rnqstliyylltpdspigkfhkninriihilqrgkgqyvlvypdgqvksfkvgfdyknge
vsqwvvpggvfkasfllpneefdngflisevvvpgfdfedhtflkgedelkhlvgpekaa
elaflahh

Timeline for d1xe8c_:

• d1xe8c_ is new in SCOP 1.71
  
• d1xe8c_ appears in SCOP 1.73
  
• d1xe8c_ appears in the current release, SCOPe 2.08, called d1xe8c1