![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
![]() | Family b.82.1.16: YML079-like [117318] (4 proteins) Pfam PF06172; DUF985 |
![]() | Protein Hypothetical protein YML079W [117319] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117320] (2 PDB entries) Uniprot Q03629 |
![]() | Domain d1xe8c1: 1xe8 C:9-201 [115218] Other proteins in same PDB: d1xe8a2, d1xe8b2, d1xe8c2 Structural genomics target complexed with ade, cit, gol |
PDB Entry: 1xe8 (more details), 2.8 Å
SCOPe Domain Sequences for d1xe8c1:
Sequence, based on SEQRES records: (download)
>d1xe8c1 b.82.1.16 (C:9-201) Hypothetical protein YML079W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} anaaiepasfvkvpmpeppsslqqlindwqlikhreggyfketdrspytmevekpvnggs gntemvtrnqstliyylltpdspigkfhkninriihilqrgkgqyvlvypdgqvksfkvg fdykngevsqwvvpggvfkasfllpneefdngflisevvvpgfdfedhtflkgedelkhl vgpekaaelafla
>d1xe8c1 b.82.1.16 (C:9-201) Hypothetical protein YML079W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} anaaiepasfvkvpmpeppsslqqlindwqlikhreggyfketdrspytmevekptemvt rnqstliyylltpdspigkfhkninriihilqrgkgqyvlvypdgqvksfkvgfdyknge vsqwvvpggvfkasfllpneefdngflisevvvpgfdfedhtflkgedelkhlvgpekaa elafla
Timeline for d1xe8c1:
![]() Domains from other chains: (mouse over for more information) d1xe8a1, d1xe8a2, d1xe8b1, d1xe8b2 |