SCOPe 2.05: Domain d1xe8b_: 1xe8 B:

Lineage for d1xe8b_ (1xe8 B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.16: YML079-like [117318] (4 proteins)
   Pfam PF06172; DUF985

6. Protein Hypothetical protein YML079W [117319] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117320] (2 PDB entries)
   Uniprot Q03629

8. Domain d1xe8b_: 1xe8 B: [115217]
   Structural genomics target
   complexed with ade, cit, gol

Details for d1xe8b_

PDB Entry: 1xe8, 2.8 Å

PDB Description: crystal structure of the yml079w protein from saccharomyces cerevisiae reveals a new sequence family of the jelly roll fold.

PDB Compounds: (B:) Hypothetical 22.5 kDa protein in TUB1-CPR3 intergenic region

SCOPe Domain Sequences for d1xe8b_:

Sequence, based on SEQRES records:

>d1xe8b_ b.82.1.16 (B:) Hypothetical protein YML079W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qeaanaaiepasfvkvpmpeppsslqqlindwqlikhreggyfketdrspytmevekpvn
ggsgntemvtrnqstliyylltpdspigkfhkninriihilqrgkgqyvlvypdgqvksf
kvgfdykngevsqwvvpggvfkasfllpneefdngflisevvvpgfdfedhtflkgedel
khlvgpekaaelaflah

Sequence, based on observed residues (ATOM records):

>d1xe8b_ b.82.1.16 (B:) Hypothetical protein YML079W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qeaanaaiepasfvkvpmpeppsslqqlindwqlikhreggyfketdrspytmevekpvg
ntemvtrnqstliyylltpdspigkfhkninriihilqrgkgqyvlvypdgqvksfkvgf
dykngevsqwvvpggvfkasfllpneefdngflisevvvpgfdfedhtflkgedelkhlv
gpekaaelaflah

Timeline for d1xe8b_:

• d1xe8b_ first appeared in SCOP 1.71
  
• d1xe8b_ appears in SCOPe 2.04
  
• d1xe8b_ is called d1xe8b1 in SCOPe 2.06
  
• d1xe8b_ appears in the current release, SCOPe 2.08, called d1xe8b1