SCOPe 2.05: Domain d1xe7c_: 1xe7 C:

Lineage for d1xe7c_ (1xe7 C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.16: YML079-like [117318] (4 proteins)
   Pfam PF06172; DUF985

6. Protein Hypothetical protein YML079W [117319] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117320] (2 PDB entries)
   Uniprot Q03629

8. Domain d1xe7c_: 1xe7 C: [115215]
   structural genomics target
   complexed with acy, edo, gun

Details for d1xe7c_

PDB Entry: 1xe7, 1.75 Å

PDB Description: crystal structure of the yml079w protein from saccharomyces cerevisiae reveals a new sequence family of the jelly roll fold

PDB Compounds: (C:) Hypothetical 22.5 kDa protein in TUB1-CPR3 intergenic region

SCOPe Domain Sequences for d1xe7c_:

Sequence, based on SEQRES records:

>d1xe7c_ b.82.1.16 (C:) Hypothetical protein YML079W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
anaaiepasfvkvpmpeppsslqqlindwqlikhreggyfketdrspytmevekpvnggs
gntemvtrnqstliyylltpdspigkfhkninriihilqrgkgqyvlvypdgqvksfkvg
fdykngevsqwvvpggvfkasfllpneefdngflisevvvpgfdfedhtflkgedelkhl
vgpekaaelaflahh

Sequence, based on observed residues (ATOM records):

>d1xe7c_ b.82.1.16 (C:) Hypothetical protein YML079W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
anaaiepasfvkvpmpeppsslqqlindwqlikhreggyfketdrspytmevekemvtrn
qstliyylltpdspigkfhkninriihilqrgkgqyvlvypdgqvksfkvgfdykngevs
qwvvpggvfkasfllpneefdngflisevvvpgfdfedhtflkgedelkhlvgpekaael
aflahh

Timeline for d1xe7c_:

• d1xe7c_ first appeared in SCOP 1.71
  
• d1xe7c_ appears in SCOPe 2.04
  
• d1xe7c_ is called d1xe7c1 in SCOPe 2.06
  
• d1xe7c_ appears in the current release, SCOPe 2.08, called d1xe7c1