Lineage for d1xe7b_ (1xe7 B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1807020Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1807021Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 1807457Family b.82.1.16: YML079-like [117318] (4 proteins)
    Pfam PF06172; DUF985
  6. 1807470Protein Hypothetical protein YML079W [117319] (1 species)
  7. 1807471Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117320] (2 PDB entries)
    Uniprot Q03629
  8. 1807473Domain d1xe7b_: 1xe7 B: [115214]
    structural genomics target
    complexed with acy, edo, gun

Details for d1xe7b_

PDB Entry: 1xe7 (more details), 1.75 Å

PDB Description: crystal structure of the yml079w protein from saccharomyces cerevisiae reveals a new sequence family of the jelly roll fold
PDB Compounds: (B:) Hypothetical 22.5 kDa protein in TUB1-CPR3 intergenic region

SCOPe Domain Sequences for d1xe7b_:

Sequence, based on SEQRES records: (download)

>d1xe7b_ b.82.1.16 (B:) Hypothetical protein YML079W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
naaiepasfvkvpmpeppsslqqlindwqlikhreggyfketdrspytmevekpvnggsg
ntemvtrnqstliyylltpdspigkfhkninriihilqrgkgqyvlvypdgqvksfkvgf
dykngevsqwvvpggvfkasfllpneefdngflisevvvpgfdfedhtflkgedelkhlv
gpekaaelaflah

Sequence, based on observed residues (ATOM records): (download)

>d1xe7b_ b.82.1.16 (B:) Hypothetical protein YML079W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
naaiepasfvkvpmpeppsslqqlindwqlikhreggyfketdrspytmevekpvntemv
trnqstliyylltpdspigkfhkninriihilqrgkgqyvlvypdgqvksfkvgfdykng
evsqwvvpggvfkasfllpneefdngflisevvvpgfdfedhtflkgedelkhlvgpeka
aelaflah

SCOPe Domain Coordinates for d1xe7b_:

Click to download the PDB-style file with coordinates for d1xe7b_.
(The format of our PDB-style files is described here.)

Timeline for d1xe7b_: