SCOP 1.71: Domain d1xe7a_: 1xe7 A:

Lineage for d1xe7a_ (1xe7 A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (16 families)

5. Family b.82.1.16: YML079-like [117318] (1 protein)
   Pfam 06172; DUF985

6. Protein Hypothetical protein YML079W [117319] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117320] (2 PDB entries)

8. Domain d1xe7a_: 1xe7 A: [115213]

Details for d1xe7a_

PDB Entry: 1xe7, 1.75 Å

PDB Description: crystal structure of the yml079w protein from saccharomyces cerevisiae reveals a new sequence family of the jelly roll fold

SCOP Domain Sequences for d1xe7a_:

Sequence, based on SEQRES records:

>d1xe7a_ b.82.1.16 (A:) Hypothetical protein YML079W {Baker's yeast (Saccharomyces cerevisiae)}
anaaiepasfvkvpmpeppsslqqlindwqlikhreggyfketdrspytmevekpvnggs
gntemvtrnqstliyylltpdspigkfhkninriihilqrgkgqyvlvypdgqvksfkvg
fdykngevsqwvvpggvfkasfllpneefdngflisevvvpgfdfedhtflkgedelkhl
vgpekaaelaflah

Sequence, based on observed residues (ATOM records):

>d1xe7a_ b.82.1.16 (A:) Hypothetical protein YML079W {Baker's yeast (Saccharomyces cerevisiae)}
anaaiepasfvkvpmpeppsslqqlindwqlikhreggyfketdrspytmevekpvmvtr
nqstliyylltpdspigkfhkninriihilqrgkgqyvlvypdgqvksfkvgfdykngev
sqwvvpggvfkasfllpneefdngflisevvvpgfdfedhtflkgedelkhlvgpekaae
laflah

Timeline for d1xe7a_:

• d1xe7a_ is new in SCOP 1.71
  
• d1xe7a_ appears in SCOP 1.73
  
• d1xe7a_ appears in the current release, SCOPe 2.08, called d1xe7a1