SCOP 1.71: Domain d1xe3f_: 1xe3 F:

Lineage for d1xe3f_ (1xe3 F:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (6 proteins)

6. Protein Purine nucleoside phosphorylase, PNP [53169] (9 species)

7. Species Bacillus anthracis [TaxId:1392] [117655] (1 PDB entry)

8. Domain d1xe3f_: 1xe3 F: [115212]
   complexed with cl

Details for d1xe3f_

PDB Entry: 1xe3, 2.24 Å

PDB Description: Crystal Structure of purine nucleoside phosphorylase DeoD from Bacillus anthracis

SCOP Domain Sequences for d1xe3f_:

Sequence; same for both SEQRES and ATOM records:

>d1xe3f_ c.56.2.1 (F:) Purine nucleoside phosphorylase, PNP {Bacillus anthracis}
msvhieakqgeiaesillpgdplrakyiaetfledvtcynnvrgmlgftgtykgkrvsvq
gtgmgvpsisiyvneliqsygvknlirvgtcgaiqkdvkvrdviiamtactdsnmnrltf
pgfdfapaanfdllkkaydagtekglhvrvgnvltadvfyresmdmvkklgdygvlavem
ettalytlaakygvnalsvltvsdhiftgeettseerqttfnemieialdaai

Timeline for d1xe3f_:

• d1xe3f_ is new in SCOP 1.71
  
• d1xe3f_ appears in SCOP 1.73
  
• d1xe3f_ appears in the current release, SCOPe 2.08