SCOP 1.73: Domain d1xe3c_: 1xe3 C:

Lineage for d1xe3c_ (1xe3 C:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (6 proteins)

6. Protein Purine nucleoside phosphorylase, PNP [53169] (9 species)

7. Species Bacillus anthracis [TaxId:1392] [117655] (2 PDB entries)

8. Domain d1xe3c_: 1xe3 C: [115209]

Details for d1xe3c_

PDB Entry: 1xe3, 2.24 Å

PDB Description: Crystal Structure of purine nucleoside phosphorylase DeoD from Bacillus anthracis

PDB Compounds: (C:) purine nucleoside phosphorylase

SCOP Domain Sequences for d1xe3c_:

Sequence; same for both SEQRES and ATOM records:

>d1xe3c_ c.56.2.1 (C:) Purine nucleoside phosphorylase, PNP {Bacillus anthracis [TaxId: 1392]}
hmsvhieakqgeiaesillpgdplrakyiaetfledvtcynnvrgmlgftgtykgkrvsv
qgtgmgvpsisiyvneliqsygvknlirvgtcgaiqkdvkvrdviiamtactdsnmnrlt
fpgfdfapaanfdllkkaydagtekglhvrvgnvltadvfyresmdmvkklgdygvlave
mettalytlaakygvnalsvltvsdhiftgeettseerqttfnemieialdaai

Timeline for d1xe3c_:

• d1xe3c_ first appeared in SCOP 1.71
  
• d1xe3c_ appears in SCOP 1.75
  
• d1xe3c_ appears in the current release, SCOPe 2.08, called d1xe3c1