| Class b: All beta proteins [48724] (178 folds) |
| Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.3: Nucleoplasmin-like core domain [69203] (2 families) ![]() oligomerizes into a pentameric ring structure |
| Family b.121.3.1: Nucleoplasmin-like core domain [69204] (4 proteins) automatically mapped to Pfam PF03066 |
| Protein Nucleophosmin (NO38) [117086] (1 species) |
| Species African clawed frog (Xenopus laevis) [TaxId:8355] [117087] (2 PDB entries) Uniprot P07222 16-122 |
| Domain d1xe0f1: 1xe0 F:16-122 [115202] Other proteins in same PDB: d1xe0a2, d1xe0b2, d1xe0d2, d1xe0e2, d1xe0f2, d1xe0g2, d1xe0h2, d1xe0i2, d1xe0j2 |
PDB Entry: 1xe0 (more details), 1.7 Å
SCOPe Domain Sequences for d1xe0f1:
Sequence, based on SEQRES records: (download)
>d1xe0f1 b.121.3.1 (F:16-122) Nucleophosmin (NO38) {African clawed frog (Xenopus laevis) [TaxId: 8355]}
qnflfgcelkadkkeysfkveddenehqlslrtvslgasakdelhvveaeginyegktik
ialaslkpsvqptvslggfeitppvilrlksgsgpvyvsgqhlvale
>d1xe0f1 b.121.3.1 (F:16-122) Nucleophosmin (NO38) {African clawed frog (Xenopus laevis) [TaxId: 8355]}
qnflfgcelkadkkeysfkvedenehqlslrtvslgasakdelhvveaeginyegktiki
alaslkpsvqptvslggfeitppvilrlksgsgpvyvsgqhlvale
Timeline for d1xe0f1: