SCOPe 2.07: Domain d1xe0f1: 1xe0 F:16-122

Lineage for d1xe0f1 (1xe0 F:16-122)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.3: Nucleoplasmin-like core domain [69203] (2 families)
   oligomerizes into a pentameric ring structure

5. Family b.121.3.1: Nucleoplasmin-like core domain [69204] (4 proteins)
   automatically mapped to Pfam PF03066

6. Protein Nucleophosmin (NO38) [117086] (1 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [117087] (2 PDB entries)
   Uniprot P07222 16-122

8. Domain d1xe0f1: 1xe0 F:16-122 [115202]
   Other proteins in same PDB: d1xe0a2, d1xe0b2, d1xe0d2, d1xe0e2, d1xe0f2, d1xe0g2, d1xe0h2, d1xe0i2, d1xe0j2

Details for d1xe0f1

PDB Entry: 1xe0, 1.7 Å

PDB Description: The structure and function of Xenopus NO38-core, a histone binding chaperone in the nucleolus

PDB Compounds: (F:) Nucleophosmin

SCOPe Domain Sequences for d1xe0f1:

Sequence, based on SEQRES records:

>d1xe0f1 b.121.3.1 (F:16-122) Nucleophosmin (NO38) {African clawed frog (Xenopus laevis) [TaxId: 8355]}
qnflfgcelkadkkeysfkveddenehqlslrtvslgasakdelhvveaeginyegktik
ialaslkpsvqptvslggfeitppvilrlksgsgpvyvsgqhlvale

Sequence, based on observed residues (ATOM records):

>d1xe0f1 b.121.3.1 (F:16-122) Nucleophosmin (NO38) {African clawed frog (Xenopus laevis) [TaxId: 8355]}
qnflfgcelkadkkeysfkvedenehqlslrtvslgasakdelhvveaeginyegktiki
alaslkpsvqptvslggfeitppvilrlksgsgpvyvsgqhlvale

Timeline for d1xe0f1:

• d1xe0f1 first appeared in SCOP 1.71, called d1xe0f_
  
• d1xe0f1 appears in SCOPe 2.06
  
• d1xe0f1 appears in the current release, SCOPe 2.08