Lineage for d1xe0f_ (1xe0 F:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 812424Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 812523Superfamily b.121.3: Nucleoplasmin-like core domain [69203] (1 family) (S)
    oligomerizes into a pentameric ring structure
  5. 812524Family b.121.3.1: Nucleoplasmin-like core domain [69204] (3 proteins)
  6. 812532Protein Nucleophosmin (NO38) [117086] (1 species)
  7. 812533Species African clawed frog (Xenopus laevis) [TaxId:8355] [117087] (2 PDB entries)
    Uniprot P07222 16-122
  8. 812539Domain d1xe0f_: 1xe0 F: [115202]

Details for d1xe0f_

PDB Entry: 1xe0 (more details), 1.7 Å

PDB Description: The structure and function of Xenopus NO38-core, a histone binding chaperone in the nucleolus
PDB Compounds: (F:) Nucleophosmin

SCOP Domain Sequences for d1xe0f_:

Sequence, based on SEQRES records: (download)

>d1xe0f_ b.121.3.1 (F:) Nucleophosmin (NO38) {African clawed frog (Xenopus laevis) [TaxId: 8355]}
gsqnflfgcelkadkkeysfkveddenehqlslrtvslgasakdelhvveaeginyegkt
ikialaslkpsvqptvslggfeitppvilrlksgsgpvyvsgqhlvale

Sequence, based on observed residues (ATOM records): (download)

>d1xe0f_ b.121.3.1 (F:) Nucleophosmin (NO38) {African clawed frog (Xenopus laevis) [TaxId: 8355]}
gsqnflfgcelkadkkeysfkvedenehqlslrtvslgasakdelhvveaeginyegkti
kialaslkpsvqptvslggfeitppvilrlksgsgpvyvsgqhlvale

SCOP Domain Coordinates for d1xe0f_:

Click to download the PDB-style file with coordinates for d1xe0f_.
(The format of our PDB-style files is described here.)

Timeline for d1xe0f_: