Class b: All beta proteins [48724] (174 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.3: Nucleoplasmin-like core domain [69203] (1 family) oligomerizes into a pentameric ring structure |
Family b.121.3.1: Nucleoplasmin-like core domain [69204] (3 proteins) |
Protein Nucleophosmin (NO38) [117086] (1 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [117087] (2 PDB entries) Uniprot P07222 16-122 |
Domain d1xe0f_: 1xe0 F: [115202] |
PDB Entry: 1xe0 (more details), 1.7 Å
SCOP Domain Sequences for d1xe0f_:
Sequence, based on SEQRES records: (download)
>d1xe0f_ b.121.3.1 (F:) Nucleophosmin (NO38) {African clawed frog (Xenopus laevis) [TaxId: 8355]} gsqnflfgcelkadkkeysfkveddenehqlslrtvslgasakdelhvveaeginyegkt ikialaslkpsvqptvslggfeitppvilrlksgsgpvyvsgqhlvale
>d1xe0f_ b.121.3.1 (F:) Nucleophosmin (NO38) {African clawed frog (Xenopus laevis) [TaxId: 8355]} gsqnflfgcelkadkkeysfkvedenehqlslrtvslgasakdelhvveaeginyegkti kialaslkpsvqptvslggfeitppvilrlksgsgpvyvsgqhlvale
Timeline for d1xe0f_: