Lineage for d1xe0c_ (1xe0 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2821688Superfamily b.121.3: Nucleoplasmin-like core domain [69203] (2 families) (S)
    oligomerizes into a pentameric ring structure
  5. 2821689Family b.121.3.1: Nucleoplasmin-like core domain [69204] (4 proteins)
    automatically mapped to Pfam PF03066
  6. 2821697Protein Nucleophosmin (NO38) [117086] (1 species)
  7. 2821698Species African clawed frog (Xenopus laevis) [TaxId:8355] [117087] (2 PDB entries)
    Uniprot P07222 16-122
  8. 2821701Domain d1xe0c_: 1xe0 C: [115199]
    Other proteins in same PDB: d1xe0a2, d1xe0b2, d1xe0d2, d1xe0e2, d1xe0f2, d1xe0g2, d1xe0h2, d1xe0i2, d1xe0j2

Details for d1xe0c_

PDB Entry: 1xe0 (more details), 1.7 Å

PDB Description: The structure and function of Xenopus NO38-core, a histone binding chaperone in the nucleolus
PDB Compounds: (C:) Nucleophosmin

SCOPe Domain Sequences for d1xe0c_:

Sequence, based on SEQRES records: (download)

>d1xe0c_ b.121.3.1 (C:) Nucleophosmin (NO38) {African clawed frog (Xenopus laevis) [TaxId: 8355]}
qnflfgcelkadkkeysfkveddenehqlslrtvslgasakdelhvveaeginyegktik
ialaslkpsvqptvslggfeitppvilrlksgsgpvyvsgqhlval

Sequence, based on observed residues (ATOM records): (download)

>d1xe0c_ b.121.3.1 (C:) Nucleophosmin (NO38) {African clawed frog (Xenopus laevis) [TaxId: 8355]}
qnflfgcelkadkkeysfkvehqlslrtvslgasakdelhvveaeginyegktikialas
lkpsvqptvslggfeitppvilrlksgsgpvyvsgqhlval

SCOPe Domain Coordinates for d1xe0c_:

Click to download the PDB-style file with coordinates for d1xe0c_.
(The format of our PDB-style files is described here.)

Timeline for d1xe0c_: