Lineage for d1xdza1 (1xdz A:1-238)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893489Family c.66.1.20: Glucose-inhibited division protein B (GidB) [75264] (1 protein)
    automatically mapped to Pfam PF02527
  6. 2893490Protein Glucose-inhibited division protein B (GidB) [75265] (2 species)
    function unknown
  7. 2893491Species Bacillus subtilis [TaxId:1423] [117679] (1 PDB entry)
    Uniprot P25813
  8. 2893492Domain d1xdza1: 1xdz A:1-238 [115196]
    Other proteins in same PDB: d1xdza2

Details for d1xdza1

PDB Entry: 1xdz (more details), 1.6 Å

PDB Description: Crystal Structure of Gram_Positive Bacillus subtilis Glucose inhibited Division protein B (gidB), Structural genomics, MCSG
PDB Compounds: (A:) Methyltransferase gidB

SCOPe Domain Sequences for d1xdza1:

Sequence, based on SEQRES records: (download)

>d1xdza1 c.66.1.20 (A:1-238) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]}
mnieeftsglaekgislsprqleqfelyydmlvewnekinltsitekkevylkhfydsit
aafyvdfnqvnticdvgagagfpslpikicfphlhvtivdslnkritfleklsealqlen
ttfchdraetfgqrkdvresydivtaravarlsvlselclplvkknglfvalkaasaeee
lnagkkaittlggelenihsfklpieesdrnimvirkikntpkkyprkpgtpnkspie

Sequence, based on observed residues (ATOM records): (download)

>d1xdza1 c.66.1.20 (A:1-238) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]}
mnieeftsglaekgislsprqleqfelyydmlvewnekinltsitekkevylkhfydsit
aafyvdfnqvnticdvgagagfpslpikicfphlhvtivdslnkritfleklsealqlen
ttfchdraetfgqrkdvresydivtaravarlsvlselclplvkknglfvalkaaaeeel
nagkkaittlggelenihsfklpieesdrnimvirkikntpkkyprkpgtpnkspie

SCOPe Domain Coordinates for d1xdza1:

Click to download the PDB-style file with coordinates for d1xdza1.
(The format of our PDB-style files is described here.)

Timeline for d1xdza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xdza2