Lineage for d1xdvb3 (1xdv B:419-549)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2070980Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2070981Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2070982Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2071188Protein Son of sevenless-1 (sos-1) [50742] (2 species)
  7. 2071189Species Human (Homo sapiens) [TaxId:9606] [50744] (4 PDB entries)
    Uniprot Q07889 189-1046
  8. 2071192Domain d1xdvb3: 1xdv B:419-549 [115185]
    Other proteins in same PDB: d1xdva1, d1xdva2, d1xdvb1, d1xdvb2

Details for d1xdvb3

PDB Entry: 1xdv (more details), 4.1 Å

PDB Description: Experimentally Phased Structure of Human the Son of Sevenless protein at 4.1 Ang.
PDB Compounds: (B:) Son of sevenless protein homolog 1

SCOPe Domain Sequences for d1xdvb3:

Sequence, based on SEQRES records: (download)

>d1xdvb3 b.55.1.1 (B:419-549) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}
ikkmneiqknidgwegkdigqccnefimegtltrvgakherhiflfdglmiccksnhgqp
rlpgasnaeyrlkekffmrkvqindkddtneykhafeiilkdensvifsaksaeeknnwm
aalislqyrst

Sequence, based on observed residues (ATOM records): (download)

>d1xdvb3 b.55.1.1 (B:419-549) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}
ikkmneiqknidgwegkdigqccnefimegtltrvgakherhiflfdglmiccksneyrl
kekffmrkvqindkddtneykhafeiilkdensvifsaksaeeknnwmaalislqyrst

SCOPe Domain Coordinates for d1xdvb3:

Click to download the PDB-style file with coordinates for d1xdvb3.
(The format of our PDB-style files is described here.)

Timeline for d1xdvb3: