Lineage for d1xdva2 (1xdv A:568-1044)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006307Fold a.117: Ras GEF [48365] (1 superfamily)
    multihelical
  4. 2006308Superfamily a.117.1: Ras GEF [48366] (1 family) (S)
  5. 2006309Family a.117.1.1: Ras GEF [48367] (2 protein domains)
  6. 2006310Protein Son of sevenless protein homolog 1 (sos-1) [48368] (1 species)
  7. 2006311Species Human (Homo sapiens) [TaxId:9606] [48369] (11 PDB entries)
    Uniprot Q07889 189-1046
  8. 2006321Domain d1xdva2: 1xdv A:568-1044 [115181]
    Other proteins in same PDB: d1xdva1, d1xdva3, d1xdvb1, d1xdvb3

Details for d1xdva2

PDB Entry: 1xdv (more details), 4.1 Å

PDB Description: Experimentally Phased Structure of Human the Son of Sevenless protein at 4.1 Ang.
PDB Compounds: (A:) Son of sevenless protein homolog 1

SCOPe Domain Sequences for d1xdva2:

Sequence, based on SEQRES records: (download)

>d1xdva2 a.117.1.1 (A:568-1044) Son of sevenless protein homolog 1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}
rlpsadvyrfaepdseeniifeenmqpkagipiikagtviklierltyhmyadpnfvrtf
lttyrsfckpqellsliierfeipepepteadriaiengdqplsaelkrfrkeyiqpvql
rvlnvcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkiardng
pghnitfqsspptvewhisrpghietfdlltlhpieiarqltllesdlyravqpselvgs
vwtkedkeinspnllkmirhttnltlwfekcivetenleervavvsriieilqvfqelnn
fngvlevvsamnsspvyrldhtfeqipsrqkkileeahelsedhykkylaklrsinppcv
pffgiyltnilkteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrvesdi
krffenlnpmgnsmekeftdylfnksleieprnpkplprfpkkysyplkspgvrpsn

Sequence, based on observed residues (ATOM records): (download)

>d1xdva2 a.117.1.1 (A:568-1044) Son of sevenless protein homolog 1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}
rlpsadvyrfaepdseeniifeegipiikagtviklierltyhmyadpnfvrtflttyrs
fckpqellsliierfeipeprfrkeyiqpvqlrvlnvcrhwvehhfydferdayllqrme
efigtvrgkamkkwvesitkiiqrkkspptvewhisrpghietfdlltlhpieiarqltl
lesdlyravqpselvgsvwtkedkeinspnllkmirhttnltlwfekcivetenleerva
vvsriieilqvfqelnnfngvlevvsamnsspvyrldhtfeqipsrqkkileeahelsed
hykkylaklrsinppcvpffgiyltnilkteegnpevlkrhgkelinfskrrkvaeitge
iqqyqnqpyclrvesdikrffenlnpmgnsmekeftdylfnksleieprnpkplprfpkk
ysyplkspgvrpsn

SCOPe Domain Coordinates for d1xdva2:

Click to download the PDB-style file with coordinates for d1xdva2.
(The format of our PDB-style files is described here.)

Timeline for d1xdva2: