Lineage for d1xdva1 (1xdv A:200-404)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
    multihelical; core: 5-helical bundle
  4. Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families) (S)
    automatically mapped to Pfam PF00621
  5. Family a.87.1.1: DBL homology domain (DH-domain) [48066] (10 proteins)
    Pfam PF00621
  6. Protein Son of sevenless-1 (sos-1) [48067] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [48068] (3 PDB entries)
    Uniprot Q07889 189-1046
  8. Domain d1xdva1: 1xdv A:200-404 [115180]
    Other proteins in same PDB: d1xdva2, d1xdva3, d1xdvb2, d1xdvb3

Details for d1xdva1

PDB Entry: 1xdv (more details), 4.1 Å

PDB Description: Experimentally Phased Structure of Human the Son of Sevenless protein at 4.1 Ang.
PDB Compounds: (A:) Son of sevenless protein homolog 1

SCOPe Domain Sequences for d1xdva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xdva1 a.87.1.1 (A:200-404) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}
tyydlvkafmaeirqyirelnliikvfrepfvsnsklfsandvenifsrivdihelsvkl
lghiedtvemtdegsphplvgscfedlaeelafdpyesyardilrpgfhdrflsqlskpg
aalylqsigegfkeavqyvlprlllapvyhclhyfellkqleeksedqedkeclkqaita
llnvqsgmekicskslakrrlsesa

SCOPe Domain Coordinates for d1xdva1 are not available.

Timeline for d1xdva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xdva2, d1xdva3
View in 3D
Domains from other chains:
(mouse over for more information)
d1xdvb1, d1xdvb2, d1xdvb3