Lineage for d1xdsa2 (1xds A:102-357)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129522Family c.66.1.12: Plant O-methyltransferase, C-terminal domain [64111] (6 protein domains)
    automatically mapped to Pfam PF00891
  6. 2129523Protein Aclacinomycin-10-hydroxylase RdmB [102554] (1 species)
    evolved a different function; binds SAM and SAH
  7. 2129524Species Streptomyces purpurascens [TaxId:1924] [102555] (4 PDB entries)
    Uniprot Q54527
  8. 2129527Domain d1xdsa2: 1xds A:102-357 [115175]
    Other proteins in same PDB: d1xdsa1, d1xdsb1
    complexed with dra, sam

Details for d1xdsa2

PDB Entry: 1xds (more details), 2.3 Å

PDB Description: Crystal structure of Aclacinomycin-10-hydroxylase (RdmB) in complex with S-adenosyl-L-methionine (SAM) and 11-deoxy-beta-rhodomycin (DbrA)
PDB Compounds: (A:) Protein RdmB

SCOPe Domain Sequences for d1xdsa2:

Sequence, based on SEQRES records: (download)

>d1xdsa2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]}
hpaqqrawldlngavshadlaftglldvvrtgrpayagrygrpfwedlsadvaladsfda
lmscdedlayeapadaydwsavrhvldvgggnggmlaaialraphlrgtlvelagpaera
rrrfadagladrvtvaegdffkplpvtadvvllsfvllnwsdedaltilrgcvralepgg
rllvldradvegdgadrffstlldlrmltfmggrvrtrdevvdlagsaglalasertsgs
ttlpfdfsileftavs

Sequence, based on observed residues (ATOM records): (download)

>d1xdsa2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]}
hpaqqrawldlngavshadlaftglldvvrtgrpayagrygrpfwedlsadvaladsfda
lmscddaydwsavrhvldvgggnggmlaaialraphlrgtlvelagpaerarrrfadagl
adrvtvaegdffkplpvtadvvllsfvllnwsdedaltilrgcvralepggrllvldrad
vegdgadrffstlldlrmltfmggrvrtrdevvdlagsaglalasertsgsttlpfdfsi
leftavs

SCOPe Domain Coordinates for d1xdsa2:

Click to download the PDB-style file with coordinates for d1xdsa2.
(The format of our PDB-style files is described here.)

Timeline for d1xdsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xdsa1